Welcome to cocoman.biz
Default Language
Default Default
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Joey High Res Switch
Joey High Res Switch
Joey High Res Switch
Joey High Res Switch
Notify me when product is back in stock

Joey High Res Switch

Product Code: JOEYHR
Brand: COCOMAN
Product Condition: New
weight: 13oz
$70.00 inc. tax
 Add to Cart
Description
Switch between 3 joysticks or mice and then select to use the left or right joystick ports on your coco. No more swapping joystick ports. Switch between standard and high-resolution modes with the built in high resolution joystick interface. Plus switch between Tandy high resolution mode and MAX mode (For use with Colorware software such as Cocomax3).
If desired you can opt not to have MAX (colorware) mode built into the unit.
The Joey High Res also features a cassette port pass through and allows for cassette operation when in standard res mode.
3 selector knob color colors to choose from.s item is r
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i